Bioinformatics Answers

Questions: 32

Free Answers by our Experts: 17

Ask Your question

Need a fast expert's response?

Submit order

and get a quick answer at the best price

for any assignment or question with DETAILED EXPLANATIONS!

Search & Filtering

Compute the pair sequence alignment using generalGap.py and localAlign.py scripts for the following sequences: (a) THISSEQUENCE CONSEQUENCE (b) ALIGNMENT ASSIGNMENT (c) NARCISSUS NARCISSIST (d) THISISTHELINE THISLINEISALIGNED (e) PARALOGUE HOMOLOGUE
AGATCTCGATCCCGCGAAATTAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTAACTTTAA Write the nucleotide sequence for T7 promoter
Light energy absorbed by the pigment molecules of antenna complex transfer it to which part of reaction center
What are the three parts of a nucleotide?
i have an amino acid sequence. The question is to write the stop codon in cDNA format.the amino acid sequence is this : MMTNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIV LIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRD YGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRR MYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEI DRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQALFSGDLKSLSAKELKDGFKDVPQVTLS NDTTNIVEVLIETGISPSKRQAREDVNNGAIYINGERQQDVNYALAPEDKIDGEFTIIRRGKKKYFMVNY Q
If two domains from a single protein are aligned with each other, what would be the reason for the positions of i.e. 15 cysteine residues being conserved in both?
The challenge with protein arrays is?
Proteins are NOT good as biomarkers because? They're levels are more accurately quantified They have low levels of expression They have different 3D structures
If two domains from a single protein are aligned with each other, what would be the reason for the positions of i.e. 15 cysteine residues being conserved in both?
If two domains from a single protein are aligned with each other, what would be the reason for the positions of i.e. 15 alanine residues being conserved in both?
LATEST TUTORIALS
New on Blog
APPROVED BY CLIENTS