65 713
Assignments Done
99,2%
Successfully Done
In October 2018

Bioinformatics Answers

Questions: 28

Free Answers by our Experts: 13

Ask Your question

Need a fast expert's response?

Submit order

and get a quick answer at the best price

for any assignment or question with DETAILED EXPLANATIONS!

Search & Filtering

i have an amino acid sequence. The question is to write the stop codon in cDNA format.the amino acid sequence is this : MMTNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIV LIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRD YGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRR MYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEI DRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQALFSGDLKSLSAKELKDGFKDVPQVTLS NDTTNIVEVLIETGISPSKRQAREDVNNGAIYINGERQQDVNYALAPEDKIDGEFTIIRRGKKKYFMVNY Q
If two domains from a single protein are aligned with each other, what would be the reason for the positions of i.e. 15 cysteine residues being conserved in both?
The challenge with protein arrays is?
Proteins are NOT good as biomarkers because?

They're levels are more accurately quantified

They have low levels of expression

They have different 3D structures
If two domains from a single protein are aligned with each other, what would be the reason for the positions of i.e. 15 cysteine residues being conserved in both?
If two domains from a single protein are aligned with each other, what would be the reason for the positions of i.e. 15 alanine residues being conserved in both?
What criteria do restriction enzymes have to meet when deciding which to choose in order to clone a specific gene into the multiple cloning site of a plasmid (e.g. pUC18)?
Biological Sequence alignment.
a) Calculate the alignment score for different alignments and indicate the best possible
aligned sequence for the following sequence:
ACCTAGCTAGCCGAT
ACCCCTAGGCGAAA
Use Match: +1, Mismatch:-1 and Indel: -2
i. Show all possible alignments and their scores
ii. Which is the best possible alignment? State the reason.
b) Carry out a Multiple Sequence Alignment (MSA) for the protein Ras 1. Use the UniProt
(http://www.uniprot.org/) database for retrieving the protein sequence of keratin type2.
The protein sequences from the following organisms must be included in your MSA.
1) Homo sapiens (Human)
2) Drosophila melanogaster (Fruit Fly)
3) Candida albicans (Yeast)
4) Mus musculus (Mouse)
5) Gallus gallus (Chicken)
Calculating information content in DNA
If both parents have different VNTR clusters at their homologous chromosomes then find out the chances of 3 VNTR clusters matching in their two children.
Submit
Privacy policy Terms and Conditions